PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G203000.1
Common NamePHAVU_001G203000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family CO-like
Protein Properties Length: 353aa    MW: 39264.2 Da    PI: 6.3697
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G203000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.54.9e-07952340
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                        +r C+ +++  + l+C+ ++  lC +C  e H+       Ht++
  Phvul.001G203000.1  9 ARPCDYCGHSTAVLYCRADSAKLCFSCDREVHSTnqlfskHTRT 52
                        678******99*********************668888888876 PP

2zf-B_box27.85.3e-095497542
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvpl 42
                         C+ +++ ++++ C ++ + lC++C  e+H +       H+++pl
  Phvul.001G203000.1 54 LCDACDDSPATILCSTDTSVLCQNCDWEKH-NpalsdslHQRRPL 97
                        7*****************************.54899999988775 PP

3CCT62.11.8e-21306349144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         R+ allRYk+K+ktR+++K+irYesRK++AesR RvKGrF+k +
  Phvul.001G203000.1 306 RDSALLRYKQKKKTRRYDKHIRYESRKVRAESRVRVKGRFAKME 349
                         899**************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.2E-14754IPR000315B-box-type zinc finger
PROSITE profilePS5011910.58754IPR000315B-box-type zinc finger
PfamPF006435.7E-6852IPR000315B-box-type zinc finger
CDDcd000213.38E-71054No hitNo description
PROSITE profilePS5011910.1395097IPR000315B-box-type zinc finger
CDDcd000212.19E-55497No hitNo description
PfamPF006438.7E-75496IPR000315B-box-type zinc finger
SMARTSM003360.125597IPR000315B-box-type zinc finger
PROSITE profilePS5101714.485306348IPR010402CCT domain
PfamPF062038.6E-16306348IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MTAEPPKPAR PCDYCGHSTA VLYCRADSAK LCFSCDREVH STNQLFSKHT RTLLCDACDD  60
SPATILCSTD TSVLCQNCDW EKHNPALSDS LHQRRPLEGF TGCPSVSELL SVVGFGDLSK  120
KSLLSSPQGS AADGFLGCEI EGLSDLFVWD APSIVTIDDL ICSSASSHSF QAMEVPPLPK  180
NRKAACGRHR EEILSQLREL AKSEPLDPEQ SVQPGNLSSA FERDVEADII PYHEWHRESV  240
EPMYQVVPPD PSLRTYTEEI LVKQSTYVGE THTFVDKGGN LSISLNSETL PTTPKAAACE  300
LTSQERDSAL LRYKQKKKTR RYDKHIRYES RKVRAESRVR VKGRFAKMEQ EH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1314320QKKKTRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0688960.0HM068896.1 Glycine max CONSTANS-like zinc finger protein (COL15) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007163063.10.0hypothetical protein PHAVU_001G203000g
RefseqXP_007163062.10.0hypothetical protein PHAVU_001G203000g
TrEMBLV7D1I40.0V7D1I4_PHAVU; Uncharacterized protein
STRINGGLYMA03G36810.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70553145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.18e-92B-box type zinc finger protein with CCT domain